PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00186g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 195aa    MW: 22557.8 Da    PI: 5.2725
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00186g00004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.71.3e-12746746
                              HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                    SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                              s r+v + +  +  +KKA+ELSvLCd+  a+iifs++ k+
  Peinf101Scf00186g00004.1  7 SERNVLLHRKVANFFKKAQELSVLCDVGLAIIIFSPDEKI 46
                              56777777777889**********************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.003152IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.774746IPR002100Transcription factor, MADS-box
PfamPF003194.8E-11746IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-14885IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MASNTVSERN VLLHRKVANF FKKAQELSVL CDVGLAIIIF SPDEKIPIMW PSETKVRQIL  60
TSYLGRSEFQ RSKKLVLHEN YLREKLEARV EEIRKMEEKK EMEFLFNQLV MGMSIYDLDA  120
KQLRGLIKLA TLKKAKVDER KQQLEEKRMK HLNEDDVQPV EPPAAGGESG KEPEPEEADN  180
NNAGEEKDDE LPKDY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1685130.0FJ168513.1 Petunia x hybrida type I MADS box transcription factor (MADSy8) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794692.13e-42PREDICTED: MADS-box protein AGL24-like
RefseqXP_016468130.13e-42PREDICTED: MADS-box protein AGL71-like
TrEMBLB6DT651e-116B6DT65_PETHY; Type I MADS box transcription factor (Fragment)
STRINGPGSC0003DMT4000850372e-40(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31640.15e-12AGAMOUS-like 92